$('.lia-button-wrapper-searchForm-action').removeClass('active'); $(event.data.selector).addClass('cssmenu-open') "action" : "rerender" }, "componentId" : "kudos.widget.button", ] { ], } } LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_20","feedbackSelector":".InfoMessage"}); LITHIUM.MessageBodyDisplay('#bodyDisplay_1', '.lia-truncated-body-container', '#viewMoreLink', '.lia-full-body-container' ); $('.lia-autocomplete-footer').append(ctaHTML); "action" : "rerender" { "actions" : [ ', 'ajax'); "useSubjectIcons" : "true", }); ] LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:userExistsQuery","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":"#userSearchField_6f0e1a8886bdee","action":"userExistsQuery","feedbackSelector":"#ajaxfeedback_6f0e1a8886bdee_0","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.usersearchfield:userexistsquery?t:ac=board-id/Archiv_CallYa/thread-id/63178&t:cp=search/contributions/page","ajaxErrorEventName":"LITHIUM:ajaxError","token":"7f-LXrFcAg_cihXmeL9pt89XaTlVNaSZJqQjODXK8wg. { $('#node-menu li.has-sub>a').on('click', function(){ }, /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ ] ] } ] "linkDisabled" : "false" ] "activecastFullscreen" : false, LITHIUM.Loader.runJsAttached(); "event" : "MessagesWidgetCommentForm", } { "actions" : [ LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_0","componentSelector":"#lineardisplaymessageviewwrapper_0","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1854735,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_23","feedbackSelector":".InfoMessage"}); }, "useTruncatedSubject" : "true", 5 euro Guthaben weg. }, ], "context" : "", "ajaxEvent" : "LITHIUM:lightboxRenderComponent", "event" : "ProductAnswer", LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_4","componentSelector":"#lineardisplaymessageviewwrapper_4","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1996324,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. "displaySubject" : "true", "action" : "rerender" }, "event" : "expandMessage", { { { } "; ] "initiatorDataMatcher" : "data-lia-kudos-id" { }, ] LITHIUM.AjaxSupport.fromForm('#form_0', 'GiveRating', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { ] "actions" : [ "actions" : [ "context" : "", ', 'ajax');","content":"Vorschläge deaktivieren"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_14bbcf54c0145f_0","redirectToItemLink":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.searchform.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/Archiv_CallYa/thread-id/61006&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); }, "event" : "markAsSpamWithoutRedirect", "event" : "MessagesWidgetEditAction", "actions" : [ } "action" : "rerender" '; "event" : "ProductMessageEdit", "actions" : [ "context" : "", { ] "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "action" : "rerender" "event" : "ProductAnswer", Vodafone hat eine neue Gratis-Aktion bei seinen CallYa Digital Pre­paidkarten aufgelegt. { return; "parameters" : { "event" : "ProductAnswerComment", "truncateBodyRetainsHtml" : "false", "messageViewOptions" : "1111110111111111111110111110100101001101" "includeRepliesModerationState" : "false", $('.menu-container').on('click','.community-node-menu-btn:not(.active)', {'selector' : '.css-node-menu'}, handleOpen); "dialogContentCssClass" : "lia-panel-dialog-content", "componentId" : "forums.widget.message-view", "context" : "", }, }, } { ], // Register the click event handler { "actions" : [ "context" : "", "eventActions" : [ "action" : "rerender" "eventActions" : [ "actions" : [ $(".label-tag-accordion div.js-toggle-more").on('click',function(e){ } "selector" : "#messageview_3", ] } }, "actions" : [ }, ] }, { watching = false; $('.menu-container').on('click','.community-user-menu-btn.active', {'selector' : '.css-user-menu' }, handleClose); } "disableLinks" : "false", ], "eventActions" : [ else { $(".ForumTopicPage .lia-form-tags-delimited-by-commas-input").attr('placeholder',"Enter Tags"); { "actions" : [ "actions" : [ "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "includeRepliesModerationState" : "false", }, { { { "parameters" : { "disableLinks" : "false", { "actions" : [ } "linkDisabled" : "false" ] { "revokeMode" : "true", { "disableKudosForAnonUser" : "false", "event" : "addThreadUserEmailSubscription", ] } }, ","loaderSelector":"#lineardisplaymessageviewwrapper_3 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); .attr('aria-hidden','true') { "actions" : [ }, }, "event" : "approveMessage", { "dialogKey" : "dialogKey" }, Bist du sicher, dass du fortfahren möchtest? "actions" : [ } "activecastFullscreen" : false, LITHIUM.Auth.CHECK_SESSION_TOKEN = 'nS-7GCOJa5_5KKdDmDWCkHCTdgpWYwq_ag7spxMyn_Y. "event" : "removeThreadUserEmailSubscription", resetMenu(); { ] "selector" : "#kudosButtonV2", } "context" : "envParam:quiltName,product,contextId,contextUrl", else { /*$(".ForumTopicPage .AddMessageTags .lia-button-Submit-action").attr("value","");*/ { "context" : "", "disableLinks" : "false", count = 0; }, ] "truncateBody" : "true", Execute whatever should happen when entering the right sequence ] { "actions" : [ }, "event" : "editProductMessage", { }); "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); { "actions" : [ $(this).toggleClass("view-btn-open view-btn-close"); }, { }); "action" : "rerender" "event" : "MessagesWidgetEditAnswerForm", "actions" : [ "linkDisabled" : "false" ] "event" : "deleteMessage", ] } event.preventDefault(); { }, "entity" : "1953398", "action" : "rerender" LITHIUM.StarRating('#any_0_1', true, 2, 'LITHIUM:starRating'); "action" : "rerender" ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); "event" : "AcceptSolutionAction", { "event" : "deleteMessage", "useTruncatedSubject" : "true", } } "actions" : [ ] "actions" : [ "initiatorBinding" : true, "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "selector" : "#messageview_1", // Oops. LITHIUM.StarRating('#any_3', false, 1, 'LITHIUM:starRating'); watching = false; } { "context" : "", "event" : "RevokeSolutionAction", }, // console.log('watching: ' + key); { "action" : "rerender" "revokeMode" : "true", ","ignoreOnChangeCssClasses":[],"disableFormOnSubmit":true,"buttonWrapperSelector":".lia-button-wrapper","showUnsavedDataWarningDataKey":"showUnsavedDataWarning","liaBodyTagId":"#lia-body"}); }, } "initiatorDataMatcher" : "data-lia-message-uid" "includeRepliesModerationState" : "false", { "action" : "rerender" var resetMenu = function() { } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_5","menuItemsSelector":".lia-menu-dropdown-items"}}); "actions" : [ "}); { }, }, "action" : "pulsate" "event" : "ProductAnswerComment", "actions" : [ { "disableLabelLinks" : "false", { { } } "context" : "envParam:feedbackData", "displaySubject" : "true", var keycodes = { "action" : "rerender" "eventActions" : [ "action" : "rerender" element.siblings('li').find('ul').slideUp(); "actions" : [ event.returnValue = false; { "actions" : [ "actions" : [ }, "context" : "", LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_1","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_1","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/63178","ajaxErrorEventName":"LITHIUM:ajaxError","token":"1H_RC34lIE5RSVBycuaAsBrYMVgDEK2cfCOQsCUf5ig. "messageViewOptions" : "1111110111111111111110111110100101001101" LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"lineardisplaymessageviewwrapper_1","componentSelector":"#lineardisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":1855748,"confimationText":"Du hast andere Nachrichten-Editoren geöffnet, deren Daten verlorengehen könnten. }, "}); "context" : "", { "context" : "envParam:messageUid,page,quiltName,product,contextId,contextUrl", "displayStyle" : "horizontal", ] ] { window.location.replace('/t5/user/userloginpage'); "event" : "ProductAnswer", ] "action" : "rerender" "closeEvent" : "LITHIUM:lightboxCloseEvent", "actions" : [ "actions" : [ // just for convenience, you need a login anyways... "context" : "", "event" : "kudoEntity", } "initiatorDataMatcher" : "data-lia-message-uid" "actions" : [ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "actions" : [ "context" : "envParam:quiltName", "event" : "unapproveMessage", { { "context" : "envParam:quiltName", "action" : "rerender" } "}); "useSimpleView" : "false", "actions" : [ "actions" : [ // Oops. { "componentId" : "kudos.widget.button", { LITHIUM.InputEditForm("form_1", {"submitButton":".lia-button-Submit-action","enableFormButtonEvent":"LITHIUM:enableFormButton","warnUnsavedDataActionCssClasses":["lia-form-action-ignore-unsaved-data"],"useUnsavedDataWarning":false,"ignoreDisableFormDuringSubmitCssClasses":[],"submitOnChange":true,"swallowEnterEvent":false,"enableFormEvent":"LITHIUM:enableForm","disableFormButtonEvent":"LITHIUM:disableFormButton","disableFormEvent":"LITHIUM:disableForm","unloadMessage":"Nicht gespeicherte Informationen gehen verloren. { { .attr('aria-expanded','true') } "context" : "envParam:feedbackData", }, { "event" : "QuickReply", ] ] "}); "closeImageIconURL" : "https://forum.vodafone.de/skins/images/45B87A006C51668DB4413BFFEA3E02D0/responsive_peak/images/button_dialog_close.svg", "action" : "rerender" { } }, "actions" : [ "context" : "envParam:quiltName,product,contextId,contextUrl", ] } ] { $('#vodafone-community-header .lia-search-input-wrapper').hide(); "truncateBody" : "true", "actions" : [ { { LITHIUM.AjaxSupport.fromForm('#form_3', 'GiveRating', '#ajaxfeedback_3', 'LITHIUM:ajaxError', {"useLoader":true,"event":"submit","httpMethod":"POST"}, true); { } "event" : "AcceptSolutionAction", "action" : "rerender" "action" : "rerender" "context" : "", "actions" : [ "action" : "rerender" // just for convenience, you need a login anyways... } "actions" : [ var ctaHTML = ''; "action" : "rerender" { "event" : "kudoEntity", "context" : "", "context" : "envParam:feedbackData", LITHIUM.Auth.CHECK_SESSION_TOKEN = 'nS-7GCOJa5_5KKdDmDWCkHCTdgpWYwq_ag7spxMyn_Y. { { "event" : "MessagesWidgetMessageEdit", "context" : "", "context" : "", ] }, "disableKudosForAnonUser" : "false", } "event" : "ProductAnswer", }, }, "actions" : [ watching = false; "actions" : [ "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:entity", { ] "context" : "", $('#node-menu li.has-sub>a').on('click', function(){ "event" : "addMessageUserEmailSubscription", } ] "actions" : [ LITHIUM.Auth.KEEP_ALIVE_URL = '/t5/status/blankpage?keepalive'; LITHIUM.Loader.runJsAttached(); var resetMenu = function() { { { "actions" : [ ","loaderSelector":"#lineardisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); }, }, { "context" : "", "context" : "envParam:quiltName", }, }else{ } "}); } }, { ] "context" : "", "action" : "rerender" { { "componentId" : "kudos.widget.button", LITHIUM.AjaxSupport.fromLink('#kudoEntity_0', 'kudoEntity', '#ajaxfeedback_0', 'LITHIUM:ajaxError', {}, 'E2CG8dFtkNyyhTqK4MHFVwvaqLTAvy9ZiHkZw8V5Vaw. { }, { ] "event" : "unapproveMessage", "action" : "rerender" } } ] //$('#lia-body').addClass('lia-window-scroll'); $('#vodafone-community-header .lia-search-toggle').click(function() { { ] "kudosLinksDisabled" : "false", "context" : "", } "event" : "ProductMessageEdit", }, } LITHIUM.Auth.API_URL = '/t5/util/authcheckpage'; { } } LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); ] }, { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_25","feedbackSelector":".InfoMessage"}); } { Vodafone testet ein neues Angebot für mobile Internetnutzung unter den CallYa-Kunden. { LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_22","feedbackSelector":".InfoMessage"}); "action" : "rerender" }, } }, "actions" : [ { Vertrag verlängern & wechseln; Mehr für Dich . } }, "action" : "rerender" "action" : "rerender" ] { { "disallowZeroCount" : "false", "actions" : [ "actions" : [ } "context" : "", "eventActions" : [ LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:partialRenderProxyRelay","parameters":{"javascript.ignore_combine_and_minify":"true"}},"tokenId":"ajax","elementSelector":document,"action":"partialRenderProxyRelay","feedbackSelector":false,"url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.liabase.basebody.partialrenderproxy:partialrenderproxyrelay?t:ac=board-id/Archiv_CallYa/thread-id/63178","ajaxErrorEventName":"LITHIUM:ajaxError","token":"5xIS3wPMQMOk1-M0gnxhm682YoTz87mUdqL_W-MM-TI. LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#lineardisplaymessageviewwrapper_3","action":"renderInlineEditForm","feedbackSelector":"#lineardisplaymessageviewwrapper_3","url":"https://forum.vodafone.de/t5/forums/v4/forumtopicpage.lineardisplay_1.lineardisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/Archiv_CallYa/thread-id/63178","ajaxErrorEventName":"LITHIUM:ajaxError","token":"QXu_wGgEZYmnuJTZEBfX_xpMPo0QuGBnj4onKDlRo5s.